Recombinant Human C-C motif chemokine 18 (CCL18) (Active)

• Product Name Alternative:

  Alternative macrophage activation-associated CC chemokine 1, CC chemokine PARC, Dendritic cell chemokine 1, DC-CK1, Macrophage inflammatory protein 4

• Abbreviation:

  Recombinant Human CCL18 protein (Active)

• Gene Name:

  CCL18

• UniProt:

  P55774

• Expression Region:

  21-89aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA

• Tag:

  Tag-Free

• Type:

  Active Protein & In Stock Protein

• Source:

  E.Coli

• Field of Research:

  Immunology

• Relevance:

  Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses. {ECO:0000269|PubMed:11745396, ECO:0000269|PubMed:11978786}.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  >97% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 1.0-10 ng/ml.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses.

• Molecular Weight:

  7.9 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein