Recombinant Zaire ebolavirus Matrix protein VP40 (VP40)

CAT:
399-GTR04829291
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Zaire ebolavirus Matrix protein VP40 (VP40)

  • Product Name Alternative:

    Ebola VP40 (eVP40) (Membrane-associated protein VP40)

  • Abbreviation:

    Recombinant Zaire ebolavirus VP40 protein

  • Gene Name:

    VP40

  • UniProt:

    Q77DJ6

  • Expression Region:

    1-326aa

  • Organism:

    Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)

  • Target Sequence:

    MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK

  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged

  • Type:

    In Stock Protein

  • Source:

    Baculovirus

  • Field of Research:

    Others

  • Relevance:

    Plays an essential role virus particle assembly and budding. Acts by interacting with viral ribonucleocapsid and host members of the ESCRT system such as host VPS4, PDCD6IP/ALIX, NEDD4 or TGS101. May play a role in immune cell dysfunction by being packaged into exosomes that can decrease the viability of recipient cells.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    39.1 kDa

  • References & Citations:

    "Crystal structure of the matrix protein VP40 from Ebola virus." Dessen A., Volchkov V., Dolnik O., Klenk H.-D., Weissenhorn W. EMBO J. 19:4228-4236 (2000)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length