Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP) (R127A, R130S) (Active)

• CAS Number:

  9000-83-3

• Gene Name:

  TSLP

• UniProt:

  A0A7N9CAT7

• Expression Region:

  29-159aa(R127A,R130S)

• Organism:

  Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

• Target Sequence:

  YDFTNCDFQKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKARKSKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ

• Tag:

  C-terminal 10xHis-tagged

• Source:

  Mammalian cell

• Field of Research:

  Immunology

• Assay Type:

  Active Protein & In Stock Protein

• Endotoxin:

  Less than 1.0 EU/ug as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Loaded Cynomolgus TSLP (R127A, R130S) on 96-Flat plate,  can bind anti-TSLP antibody (CSB-RA025141MA1HU),  with an affinity constant of 4.41 nM as determined in BLI assay  (Gator Prime).

• Length:

  Full Length of Mature Protein

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  16.4 kDa

• References & Citations:

  Warren W., Wilson R.K. Submitted to EMBL/GenBank/DDBJ databases (MAR-2013)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

• Protein Length:

  Full Length of Mature Protein