Recombinant Staphylococcus aureus Type VII secretion system extracellular protein B (esxB)

CAT:
399-GTR04827510
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Staphylococcus aureus Type VII secretion system extracellular protein B (esxB)

  • Product Name Alternative:

    (Ess extracellular protein B)

  • Abbreviation:

    Recombinant Staphylococcus aureus esxB protein

  • Gene Name:

    EsxB

  • UniProt:

    P0C047

  • Expression Region:

    1-104aa

  • Organism:

    Staphylococcus aureus (strain Newman)

  • Target Sequence:

    MGGYKGIKADGGKVDQAKQLAAKTAKDIEACQKQTQQLAEYIEGSDWEGQFANKVKDVLLIMAKFQEELVQPMADHQKAIDNLSQNLAKYDTLSIKQGLDRVNP

  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    Virulence factor that is important for the establishment of infection in the host. EsxB is required for EsxA synthesis as well as secretion . Mediates together with EsxA the release of S.aureus from the host cell. Inhibits also host cytokine production and thus modulates dendritic cell-mediated immunity .

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    19.0 kDa

  • References & Citations:

    "EsxA and EsxB are secreted by an ESAT-6-like system that is required for the pathogenesis of Staphylococcus aureus infections." Burts M.L., Williams W.A., DeBord K., Missiakas D.M. Proc. Natl. Acad. Sci. U.S.A. 102:1169-1174 (2005)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length