Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15) (Active)

CAT:
399-GTR04833661
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15) (Active)

  • CAS Number:

    9000-83-3

  • Gene Name:

    TNFSF15

  • UniProt:

    O95150-2

  • Expression Region:

    1-192aa

  • Organism:

    Homo sapiens

  • Target Sequence:

    MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

  • Tag:

    N-terminal 10xHis-tagged

  • Source:

    Mammalian cell

  • Field of Research:

    Cancer

  • Assay Type:

    Active Protein & In Stock Protein

  • Relevance:

    Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis.

  • Endotoxin:

    Less than 1.0 EU/ug as determined by LAL method.

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 μg/mL can bind Anti-TNFSF15 recombinant antibody (CSB-RA023992MA1HU). The EC50 is 0.8389-0.9731 ng/mL.

  • Length:

    Full Length of Isoform 2

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    24.6 kDa

  • References & Citations:

    VEGI, a novel cytokine of the tumor necrosis factor family, is an angiogenesis inhibitor that suppresses the growth of colon carcinomas in vivo. Zhai Y., Ni J., Jiang G.-W., Lu J., XIng L., Lincoln C., Carter K.C., Janat F., Kozak D FASEB J. 13:181-189 (1999)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

  • Protein Length:

    Full Length of Isoform 2