Recombinant Human Receptor for retinol uptake STRA6 (STRA6), partial

CAT:
399-GTR04831135
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Receptor for retinol uptake STRA6 (STRA6), partial

  • Product Name Alternative:

    Retinol-binding protein receptor STRA6; Stimulated by retinoic acid gene 6 protein homolog

  • Abbreviation:

    Recombinant Human STRA6 protein, partial

  • Gene Name:

    STRA6

  • UniProt:

    Q9BX79

  • Expression Region:

    1-50aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG

  • Tag:

    C-terminal hFc1-tagged

  • Type:

    In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Developmental Biology

  • Relevance:

    Functions as retinol transporter. Accepts all-trans retinol from the extracellular retinol-binding protein RBP4, facilitates retinol transport across the cell membrane, and then transfers retinol to the cytoplasmic retinol-binding protein RBP1 (PubMed:9452451, PubMed:18316031, PubMed:22665496) . Retinol uptake is enhanced by LRAT, an enzyme that converts retinol to all-trans retinyl esters, the storage forms of vitamin A (PubMed:18316031, PubMed:22665496) . Contributes to the activation of a signaling cascade that depends on retinol transport and LRAT-dependent generation of retinol metabolites that then trigger activation of JAK2 and its target STAT5, and ultimately increase the expression of SOCS3 and inhibit cellular responses to insulin (PubMed:21368206, PubMed:22665496) . Important for the homeostasis of vitamin A and its derivatives, such as retinoic acid (PubMed:18316031) . STRA6-mediated transport is particularly important in the eye, and under conditions of dietary vitamin A deficiency (Probable) . Does not transport retinoic acid (PubMed:18316031) .

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    34.2 kDa

  • References & Citations:

    "Cross talk between signaling and vitamin A transport by the retinol-binding protein receptor STRA6." Berry D.C., O'Byrne S.M., Vreeland A.C., Blaner W.S., Noy N. Mol. Cell. Biol. 32:3164-3175 (2012)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial