Recombinant Human Myosin regulatory light polypeptide 9 (MYL9) (Active)

CAT:
399-GTR04834789
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Myosin regulatory light polypeptide 9 (MYL9) (Active)

  • Product Name Alternative:

    20 kDa myosin light chain; LC20; MLC-2C; Myosin RLC; Myosin regulatory light chain 2, smooth muscle isoform; Myosin regulatory light chain 9; Myosin regulatory light chain MRLC1

  • Abbreviation:

    Recombinant Human MYL9 protein (Active)

  • Gene Name:

    MYL9

  • UniProt:

    P24844

  • Expression Region:

    2-172aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    SSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD

  • Tag:

    C-terminal 10xHis-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Yeast

  • Field of Research:

    Cancer

  • Relevance:

    May play an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Human MYL9 at 2 μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU), the EC50 is 4.628-6.430 ng/mL.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    21.7 kDa

  • References & Citations:

    "Characterization and differential expression of human vascular smooth muscle myosin light chain 2 isoform in nonmuscle cells." Kumar C.C., Mohan S.R., Zavodny P.J., Narula S.K., Leibowitz P.J. Biochemistry 28:4027-4035 (1989)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein