Recombinant Macaca fascicularis Tumor necrosis factor ligand superfamily member 6 (FASLG), partial

CAT:
399-GTR04821739
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Macaca fascicularis Tumor necrosis factor ligand superfamily member 6 (FASLG), partial

  • Product Name Alternative:

    CD95 ligand (CD95-L) (Fas antigen ligand) (Fas ligand) (FasL) (CD_antigen: CD178) (CD95L) (FASL) (TNFSF6)

  • Abbreviation:

    Recombinant Cynomolgus monkey FASLG protein, partial

  • Gene Name:

    FASLG

  • UniProt:

    P63308

  • Expression Region:

    102-211aa

  • Organism:

    Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

  • Target Sequence:

    QLFHLQKELAELRESTSQKHTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCTNLPLSHKVY

  • Tag:

    N-terminal 6xHis-tagged

  • Type:

    Developed Protein

  • Source:

    In vitro E.coli expression system

  • Field of Research:

    Cell Biology

  • Relevance:

    Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. Involved in cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development. Initiates fratricidal/suicidal activation-induced cell death in antigen-activated T-cells contributing to the termination of immune responses. TNFRSF6/FAS-mediated apoptosis has also a role in the induction of peripheral tolerance. Binds to TNFRSF6B/DcR3, a decoy receptor that blocks apoptosis.Tumor necrosis factor ligand superfamily member 6, soluble form: Induces FAS-mediated activation of NF-kappa-B, initiating non-apoptotic signaling pathways. Can induce apoptosis but does not appear to be essential for this process.FasL intracellular domain: Cytoplasmic form induces gene transcription inhibition.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    18.5 kDa

  • References & Citations:

    "Molecular cloning, functional characterization, and enzyme-linked immunosorbent assay of cynomolgus monkey Fas ligand." Kirii Y., Inoue T., Yoshino K., Kayagaki N., Yagita H., Okumura K., Shibata H., Yoshikawa Y., Terao K. J. Immunol. Methods 278:201-209 (2003)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial