Recombinant Human Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)

CAT:
399-GTR04776392
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)

  • Product Name Alternative:

    FLAP MK-886-binding protein

  • Abbreviation:

    Recombinant Human ALOX5AP protein

  • Gene Name:

    ALOX5AP

  • UniProt:

    P20292

  • Expression Region:

    1-161aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP

  • Tag:

    N-terminal 6xHis-SUMO-tagged

  • Type:

    CF Transmembrane Protein & Developed Protein

  • Source:

    In vitro E.coli expression system

  • Field of Research:

    Cardiovascular

  • Relevance:

    Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase) . Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase) . Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes.

  • Molecular Weight:

    34.2 kDa

  • References & Citations:

    "Requirement of a 5-lipoxygenase-activating protein for leukotriene synthesis." Dixon R.A.F., Diehl R.E., Opas E., Rands E., Vickers P.J., Evans J.F., Gillard J.W., Miller D.K. Nature 343:282-284 (1990)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length