Recombinant Human Zinc finger protein GLI2 (GLI2), partial

• Product Name Alternative:

  GLI family zinc finger protein 2 Tax helper protein

• Abbreviation:

  Recombinant Human GLI2 protein, partial

• Gene Name:

  GLI2

• UniProt:

  P10070

• Expression Region:

  412-641aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL

• Tag:

  N-terminal 6xHis-Myc-tagged

• Type:

  Developed Protein

• Source:

  Mammalian cell

• Field of Research:

  Epigenetics and Nuclear Signaling

• Relevance:

  Functions as transcription regulator in the hedgehog (Hh) pathway (PubMed:18455992) . Functions as transcriptional activator (PubMed:9557682, PubMed:19878745, PubMed:24311597) . May also function as transcriptional repressor (By similarity) . Requires STK36 for full transcriptional activator activity. Required for normal embryonic development (PubMed:15994174, PubMed:20685856) .By similarity1 Publication5 Publications Isoform 1, isoform 2, isoform 3 and isoform 4: Act as transcriptional activators in T-cell leukemia virus type 1 (HTLV-1) -infected cells in a Tax-dependent manner. Bind to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1 (PubMed:9557682) . Are involved in the smoothened (SHH) signaling pathway (PubMed:18455992) .3 Publications Isoform 5: Acts as a transcriptional repressor.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Functions as transcription regulator in the hedgehog (Hh) pathway

• Molecular Weight:

  30.5 kDa

• References & Citations:

  "Cloning of novel isoforms of the human Gli2 oncogene and their activities to enhance tax-dependent transcription of the human T-cell leukemia virus type 1 genome."Tanimura A., Dan S., Yoshida M.J. Virol. 72:3958-3964 (1998)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial