Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III (Fcgr3), partial

CAT:
399-GTR04827583
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III (Fcgr3), partial

  • Product Name Alternative:

    Fc-gamma RIII Short name: FcRIII CD_antigen: CD16

  • Abbreviation:

    Recombinant Mouse Fcgr3 protein, partial

  • Gene Name:

    Fcgr3

  • UniProt:

    P08508

  • Expression Region:

    31-215aa

  • Organism:

    Mus musculus (Mouse)

  • Target Sequence:

    ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT

  • Tag:

    N-terminal 6xHis-Myc-tagged

  • Type:

    In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Others

  • Relevance:

    Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor which binds to IgG1, IgG2a and IgG2b

  • Molecular Weight:

    25.2 kDa

  • References & Citations:

    "SH2-containing inositol phosphatase (SHIP-1) transiently translocates to raft domains and modulates CD16-mediated cytotoxicity in human NK cells."Galandrini R., Tassi I., Mattia G., Lenti L., Piccoli M., Frati L., Santoni A.Blood 100:4581-4589 (2002)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Extracellular Domain