Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83) -VLPs

CAT:
399-GTR04832182
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83) -VLPs

  • Product Name Alternative:

    (KK-LC-1) (Cancer/testis antigen 83)

  • Abbreviation:

    Recombinant Human CT83 protein-VLPs

  • Gene Name:

    CT83

  • UniProt:

    Q5H943

  • Expression Region:

    1-113aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

  • Tag:

    N-terminal 6xHis-tagged (This tag can be tested only under denaturing conditions)

  • Type:

    MP-VLP Transmembrane Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Cancer

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    The purity information is not available for VLPs proteins.

  • Activity:

    Not Test

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

  • Molecular Weight:

    14 kDa

  • References & Citations:

    "Cancer-testis antigen KK-LC-1 is a potential biomarker associated with immune cell infiltration in lung adenocarcinoma." Kang Y., Gan Y., Jiang Y., You J., Huang C., Chen Q., Xu X., Chen F., Chen L. BMC Cancer 22:834-834 (2022)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length