Recombinant Mouse Homeobox protein OTX2 (Otx2)

CAT:
399-GTR04836842
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Mouse Homeobox protein OTX2 (Otx2)

  • Product Name Alternative:

    Orthodenticle homolog 2 (Otx-2)

  • Abbreviation:

    Recombinant Mouse Otx2 protein

  • Gene Name:

    Otx2

  • UniProt:

    P80206

  • Expression Region:

    1-289aa

  • Organism:

    Mus musculus (Mouse)

  • Target Sequence:

    MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKSSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL

  • Tag:

    N-terminal 6xHis-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Developmental Biology

  • Relevance:

    Transcription factor probably involved in the development of the brain and the sense organs. Can bind to the bicoid/BCD target sequence: 5'-TCTAATCCC-3'.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    37.6 kDa

  • References & Citations:

    "Craniofacial, vestibular and bone defects in mice lacking the Distal-less-related gene Dlx5." Acampora D., Merlo G.R., Paleari L., Zerega B., Postiglione M.P., Mantero S., Bober E., Barbieri O., Simeone A., Levi G. Development 126:3795-3809 (1999)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length