Recombinant Clostridium acetobutylicum Butyrate--acetoacetate CoA-transferase subunit B (ctfB)

CAT:
399-GTR04836762
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Clostridium acetobutylicum Butyrate--acetoacetate CoA-transferase subunit B (ctfB)

  • Product Name Alternative:

    Acetoacetyl-CoA:acetate/butyrate CoA-transferase subunit B (Coat B)

  • Abbreviation:

    Recombinant Clostridium acetobutylicum ctfB protein

  • Gene Name:

    CtfB

  • UniProt:

    P23673

  • Expression Region:

    1-221aa

  • Organism:

    Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

  • Target Sequence:

    MINDKNLAKEIIAKRVARELKNGQLVNLGVGLPTMVADYIPKNFKITFQSENGIVGMGASPKINEADKDVVNAGGDYTTVLPDGTFFDSSVSFSLIRGGHVDVTVLGALQVDEKGNIANWIVPGKMLSGMGGAMDLVNGAKKVIIAMRHTNKGQPKILKKCTLPLTAKSQANLIVTELGVIEVINDGLLLTEINKNTTIDEIRSLTAADLLISNELRPMAV

  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Epigenetics and Nuclear Signaling

  • Relevance:

    Involved in solventogenic switch which allows C.acetobutylicum to uptake acid and produce solvents. Acts mainly to detoxify the medium by removing the acetate and butyrate excreted earlier in the fermentation.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Involved in solventogenic switch which allows C.acetobutylicum to uptake acid and produce solvents. Acts mainly to detoxify the medium by removing the acetate and butyrate excreted earlier in the fermentation.

  • Molecular Weight:

    30.6 kDa

  • References & Citations:

    "Cloning and expression of Clostridium acetobutylicum ATCC 824 acetoacetyl-coenzyme A:acetate/butyrate:coenzyme A-transferase in Escherichia coli." Cary J.W., Petersen D.J., Papoutsakis E.T., Bennett G.N. Appl. Environ. Microbiol. 56:1576-1583 (1990)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length