Recombinant Nostoc sp. Protein patA (patA)

CAT:
399-GTR04837700
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Nostoc sp. Protein patA (patA)

  • Product Name Alternative:

    PAT-1

  • Abbreviation:

    Recombinant Nostoc sp. patA protein

  • Gene Name:

    PatA

  • UniProt:

    P39048

  • Expression Region:

    1-379aa

  • Organism:

    Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

  • Target Sequence:

    MKTLPITRYRFFQKIQPLSLLKKITGKTITGCLQVFSTSGTWSIYVEEGKLIYACYSERMFEPLYRHLGNLSPQIATLPKEINEQLRAIFETGIENQAIPNPDYLAICWLVNQKYISSSQAAVLIEQLALEVVESFLMLEEGSYEFIPESFLDDLPKFCYLNVRLLVEQCQQHGRVPEAFRREASSQEISSSTEHNQIPVNNRRSTKFTSPPHTQPKPEPRLPQINTNKSTEYSKRYASQPNTVNHGYSQTSATSTDKKIYTIFCIDENPIVLNNIKNFLDDQIFAVIGVTDSLKALMEILCTKPDIILINVDMPDLDGYELCSLLRKHSYFKNTPVIMVTEKAGLVDRARAKIVRASGHLTKPFNQGDLLKVIFKHIT

  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    Controls heterocyst pattern formation. Required for the differentiation of intercalary heterocysts but not for terminal heterocysts.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Controls heterocyst pattern formation. Required for the differentiation of intercalary heterocysts but not for terminal heterocysts.

  • Molecular Weight:

    50.2 kDa

  • References & Citations:

    "Mutations in genes patA and patL of Anabaena sp. strain PCC 7120 result in similar phenotypes, and the proteins encoded by those genes may interact." Liu J., Wolk C.P. J. Bacteriol. 193:6070-6074 (2011)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length