Recombinant Human Thrombopoietin (THPO), partial

• Product Name Alternative:

  C-mpl ligand Short name: ML Megakaryocyte colony-stimulating factor Megakaryocyte growth and development factor Short name: MGDF Myeloproliferative leukemia virus oncogene ligand

• Abbreviation:

  Recombinant Human THPO protein, partial

• Gene Name:

  THPO

• UniProt:

  P40225

• Expression Region:

  22-195aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL

• Tag:

  N-terminal 6xHis-SUMO-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Cancer

• Relevance:

  Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.

• Molecular Weight:

  34.7 kDa

• References & Citations:

  "Stimulation of megakaryocytopoiesis and thrombopoiesis by the c-Mpl ligand." de Sauvage F.J., Hass P.E., Spencer S.D., Malloy B.E., Gurney A.L., Spencer S.A., Darbonne W.C., Henzel W.J., Wong S.C., Kuang W.-J., Oles K.J., Hultgren B., Solberg L.A. Jr., Goeddel D.V., Eaton D.L. Nature 369:533-538 (1994)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial