Recombinant Artemisia vulgaris Non-specific lipid-transfer protein, partial

• Product Name Alternative:

  Pollen allergen Art v 3 Allergen: Art v 3

• Abbreviation:

  Recombinant Artemisia vulgaris Non-specific lipid-transfer protein, partial

• UniProt:

  P0C088

• Expression Region:

  1-37aa

• Organism:

  Artemisia vulgaris (Mugwort)

• Target Sequence:

  ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND

• Tag:

  Tag-Free

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity) .

• Molecular Weight:

  3.8 kDa

• References & Citations:

  "Lipid-transfer proteins as potential plant panallergens: cross-reactivity among proteins of Artemisia pollen, Castanea nut and Rosaceae fruits, with different IgE-binding capacities." Diaz-Perales A., Lombardero M., Sanchez-Monge R., Garcia-Selles F.J., Pernas M., Fernandez-Rivas M., Barber D., Salcedo G. Clin. Exp. Allergy 30:1403-1410 (2000)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial