Recombinant Human Cyclin-dependent kinase 4 inhibitor D (CDKN2D)

CAT:
399-GTR04828342
Size:
1 mg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Cyclin-dependent kinase 4 inhibitor D (CDKN2D)

  • Product Name Alternative:

    P19-INK4d

  • Abbreviation:

    Recombinant Human CDKN2D protein

  • Gene Name:

    CDKN2D

  • UniProt:

    P55273

  • Expression Region:

    1-166aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL

  • Tag:

    N-terminal GST-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Cell Biology

  • Relevance:

    Interacts strongly with CDK4 and CDK6 and inhibits them

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Interacts strongly with CDK4 and CDK6 and inhibits them.

  • Molecular Weight:

    44.7 kDa

  • References & Citations:

    "Mutation testing in melanoma families: INK4A, CDK4 and INK4D." Newton Bishop J.A., Harland M., Bennett D.C., Bataille V., Goldstein A.M., Tucker M.A., Ponder B.A.J., Cuzick J., Selby P., Bishop D.T. Br. J. Cancer 80:295-300 (1999)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length