Recombinant Human Pleckstrin homology-like domain family A member 2 (PHLDA2)

• Product Name Alternative:

  Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein Imprinted in placenta and liver protein Tumor-suppressing STF cDNA 3 protein Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein p17-Beckwith-Wiedemann region 1 C

• Abbreviation:

  Recombinant Human PHLDA2 protein

• Gene Name:

  PHLDA2

• UniProt:

  Q53GA4

• Expression Region:

  1-152aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP

• Tag:

  N-terminal GST-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Cell Biology

• Relevance:

  Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids (By similarity) .

• Molecular Weight:

  44.1 kDa

• References & Citations:

  "A 2.5-Mb transcript map of a tumor-suppressing subchromosomal transferable fragment from 11p15.5, and isolation and sequence analysis of three novel genes." Hu R.-J., Lee M.P., Connors T.D., Johnson L.A., Burn T.C., Su K., Landes G.M., Feinberg A.P. Genomics 46:9-17 (1997)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length