Recombinant Human Clathrin light chain A (CLTA)

CAT:
399-GTR04832506
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Clathrin light chain A (CLTA)

  • Product Name Alternative:

    Clathrin light chain A; Clathrin light chain B; Clathrin light chain LCA; Clathrin light chain LCB; Clathrin light polypeptide A; Clathrin light polypeptide; Clathrin light polypeptide B; Clathrin light polypeptide LCA; Clathrin light polypeptide LCB; Clathrin; light chain (Lcb) ; Clathrin; light polypeptide (Lca) ; Clathrin; light polypeptide (Lcb) ; CLCA_HUMAN; CLTA; CLTB; Lca; LCB

  • Abbreviation:

    Recombinant Human CLTA protein

  • Gene Name:

    CLTA

  • UniProt:

    P09496

  • Expression Region:

    1-218aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH

  • Tag:

    N-terminal GST-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Neuroscience

  • Relevance:

    Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge

  • Molecular Weight:

    50.7 kDa

  • References & Citations:

    "Structure of human clathrin light chains. Conservation of light chain polymorphism in three mammalian species." Jackson A.P., Parham P. J. Biol. Chem. 263:16688-16695 (1988)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Isoform Non-brain