Recombinant Human Sulfotransferase 1A3 (SULT1A3)

CAT:
399-GTR04835709
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Sulfotransferase 1A3 (SULT1A3)

  • Product Name Alternative:

    Aryl sulfotransferase 1A3/1A4 Catecholamine-sulfating phenol sulfotransferase HAST3 M-PST Monoamine-sulfating phenol sulfotransferase Placental estrogen sulfotransferase Sulfotransferase 1A3/1A4 Sulfotransferase, monoamine-preferring Thermolabile phenol sulfotransferase

  • Abbreviation:

    Recombinant Human SULT1A3 protein

  • Gene Name:

    SULT1A3

  • UniProt:

    P0DMM9

  • Expression Region:

    1-295aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

  • Tag:

    N-terminal GST-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Neuroscience

  • Relevance:

    Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.

  • Molecular Weight:

    61.2 kDa

  • References & Citations:

    "Identification of two human brain aryl sulfotransferase cDNAs." Zhu X., Veronese M.E., Bernard C.C., Sansom L.N., McManus M.E. Biochem. Biophys. Res. Commun. 195:120-127 (1993)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length