Recombinant SerRatia marcescens DNA-binding protein H-NS (hns)

CAT:
399-GTR04831583
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant SerRatia marcescens DNA-binding protein H-NS (hns)

  • Product Name Alternative:

    Histone-like protein HLP-II

  • Abbreviation:

    Recombinant Serratia marcescens hns protein

  • Gene Name:

    Hns

  • UniProt:

    P18955

  • Expression Region:

    2-135aa

  • Organism:

    Serratia marcescens

  • Target Sequence:

    SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL

  • Tag:

    N-terminal 6xHis-tagged

  • Type:

    Developed Protein

  • Source:

    Yeast

  • Field of Research:

    Microbiology

  • Relevance:

    H-NS binds tightly to ds-DNA, increases its thermal stability and inhibits transcription. It also binds to ss-DNA and RNA but with a much lower affinity. H-NS has possible histone-like function. May be a global transcriptional regulator through its ability to bind to curved DNA sequences, which are found in regions upstream of a certain subset of promoters. It plays a role in the thermal control of pili production. It is subject to transcriptional auto-repression. It binds preferentially to the upstream region of its own gene recognizing two segments of DNA on both sides of a bend centered around -150 (By similarity) .

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    A DNA-binding protein implicated in transcriptional repression and chromosome organization and compaction. Binds nucleation sites in AT-rich DNA and bridges them, forming higher-order nucleoprotein complexes and condensing the chromosome. As many horizontally transferred genes are AT-rich, it plays a central role in silencing foreign genes. A subset of genes are repressed by H-NS in association with other proteins (By similarity) .

  • Molecular Weight:

    17.5 kDa

  • References & Citations:

    "Characterization of the structural genes for the DNA-binding protein H-NS in Enterobacteriaceae."la Teana A., Falconi M., Scarlato V., Lammi M., Pon C.L.FEBS Lett. 244:34-38 (1989)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein