Recombinant Human Zinc finger protein GLI2 (GLI2), partial

CAT:
399-GTR04830706
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Zinc finger protein GLI2 (GLI2), partial

  • Product Name Alternative:

    GLI family zinc finger protein 2 Tax helper protein

  • Abbreviation:

    Recombinant Human GLI2 protein, partial

  • Gene Name:

    GLI2

  • UniProt:

    P10070

  • Expression Region:

    412-641aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL

  • Tag:

    N-terminal 6xHis-SUMO-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Epigenetics and Nuclear Signaling

  • Relevance:

    Functions as transcription regulator in the hedgehog (Hh) pathway (PubMed:18455992) . Functions as transcriptional activator (PubMed:9557682, PubMed:19878745, PubMed:24311597) . May also function as transcriptional repressor (By similarity) . Requires STK36 for full transcriptional activator activity. Required for normal embryonic development (PubMed:15994174, PubMed:20685856) .

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Functions as transcription regulator in the hedgehog (Hh) pathway

  • Molecular Weight:

    42.5 kDa

  • References & Citations:

    "Novel heterozygous nonsense GLI2 mutations in patients with hypopituitarism and ectopic posterior pituitary lobe without holoprosencephaly."Franca M.M., Jorge A.A., Carvalho L.R., Costalonga E.F., Vasques G.A., Leite C.C., Mendonca B.B., Arnhold I.J.J. Clin. Endocrinol. Metab. 95:E384-E391 (2010) .

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial