Recombinant Human MORC family CW-type zinc finger protein 3 (MORC3), partial

• Product Name Alternative:

  Nuclear matrix protein 21 Zinc finger CW-type coiled-coil domain protein 3

• Abbreviation:

  Recombinant Human MORC3 protein, partial

• Gene Name:

  MORC3

• UniProt:

  Q14149

• Expression Region:

  1-290aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY

• Tag:

  N-terminal 6xHis-SUMO-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism (PubMed:20501696) . Sumoylated MORC3-NBs can also associate with PML-NBs (PubMed:20501696) . Recruits TP53 and SP100 to PML-NBs, thus regulating TP53 activity (PubMed:17332504) . Binds RNA in vitro (PubMed:11927593) . May be required for influenza A transcription during viral infection (PubMed:26202233) .

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism

• Molecular Weight:

  48.7 kDa

• References & Citations:

  "Uncovering global SUMOylation signaling networks in a site-specific manner."Hendriks I.A., D'Souza R.C., Yang B., Verlaan-de Vries M., Mann M., Vertegaal A.C.Nat. Struct. Mol. Biol. 21:927-936 (2014) .

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial