Recombinant Mouse Angiogenin-4 (Ang4)

CAT:
399-GTR04832850
Size:
500 µg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Mouse Angiogenin-4 (Ang4)

  • Product Name Alternative:

    Ang4Angiogenin-4; EC 3.1.27.-

  • Abbreviation:

    Recombinant Mouse Ang4 protein

  • Gene Name:

    Ang4

  • UniProt:

    Q3TMQ6

  • Expression Region:

    25-144aa

  • Organism:

    Mus musculus (Mouse)

  • Target Sequence:

    QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP

  • Tag:

    N-terminal 6xHis-SUMO-tagged

  • Type:

    In Stock Protein

  • Source:

    Yeast

  • Field of Research:

    Cardiovascular

  • Relevance:

    Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro) . Has low ribonuclease activity (in vitro) . Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro) . Has low ribonuclease activity (in vitro) . Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro) .

  • Molecular Weight:

    29.9 kDa

  • References & Citations:

    "Angiogenins: a new class of microbicidal proteins involved in innate immunity."Hooper L.V., Stappenbeck T.S., Hong C.V., Gordon J.I.Nat. Immunol. 4:269-273 (2003)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein