Recombinant Mouse Intercellular adhesion molecule 4 (Icam4), partial

CAT:
399-GTR04837500
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Mouse Intercellular adhesion molecule 4 (Icam4), partial

  • Product Name Alternative:

    CD_antigen: CD242

  • Abbreviation:

    Recombinant Mouse Icam4 protein, partial

  • Gene Name:

    Icam4

  • UniProt:

    Q9ERM2

  • Expression Region:

    23-231aa

  • Organism:

    Mus musculus (Mouse)

  • Target Sequence:

    QQEWMQSPPAPSVTSAPFWVRLNPELEAVPPGGSAWLNCSHNCPLPVHSSLRTQLRQGKIVNGSGWVSYQLLDVRAWNSKVRCVVTCAGETREATARITAYKRPRSVILEPPVLVGHKYTLRCYVTHVFPVGFLVVSLRRGGRVIYHESLERFTGSDLANVTLTYVMRAGLNDLWQPLTCHARLNLDGLVVRSSSAPVMLTVLALSPAS

  • Tag:

    N-terminal 6xHis-SUMO-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    Adhesion molecule that binds to leukocyte adhesion LFA-1 protein LFA-1 (integrin alpha-L/beta-2) . ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins (By similarity) . Isoform 2 may modulate binding of membrane-associated ICAM4.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Adhesion molecule that binds to leukocyte adhesion LFA-1 protein LFA-1 (integrin alpha-L/beta-2) . ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins (By similarity) . Isoform 2 may modulate binding of membrane-associated ICAM4.

  • Molecular Weight:

    39.1 kDa

  • References & Citations:

    "Novel secreted isoform of adhesion molecule ICAM-4: potential regulator of membrane-associated ICAM-4 interactions."Lee G., Spring F.A., Parsons S.F., Mankelow T.J., Peters L.L., Koury M.J., Mohandas N., Anstee D.J., Chasis J.A.Blood 101:1790-1797 (2003)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Extracellular Domain