Recombinant African cassava mosaic virus Replication-associated protein (AC1)

CAT:
399-GTR04835270
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant African cassava mosaic virus Replication-associated protein (AC1)

  • Product Name Alternative:

    40.4KDA protein; Protein AC1; Protein AL1

  • Abbreviation:

    Recombinant African cassava mosaic virus AC1 protein

  • Gene Name:

    AC1

  • UniProt:

    P14982

  • Expression Region:

    1-358aa

  • Organism:

    African cassava mosaic virus (isolate West Kenyan 844) (ACMV) (Cassava latent virus (isolate West Kenyan 844) )

  • Target Sequence:

    MRTPRFRIQAKNVFLTYPKCSIPKEHLLSFIQTLSLQSNPKFIKICRELHQNGEPHLHALIQFEGKITITNNRLFDCVHPSCSTSFHPNIQGAKSSSDVKSYLDKDGDTVEWGQFQIDGRSARGGQQSANDAYAKALNSGSKSEALNVIRELVPKDFVLQFHNLNSNLDRIFQEPPAPYVSPFPCSSFDQVPVEIEEWVADNVRDSAARPWRPNSIVIEGDSRTGKTIWARSLGPHNYLCGHLDLSPKVFNNAAWYNVIDDVDPHYLKHFKEFMGSQRDWQSNTKYGKPVQIKGGIPTIFLCNPGPTSSYKEFLAEEKQEALKAWALKNAIFITLTEPLYSGSNQSHSQTSQEASHPA

  • Tag:

    N-terminal 6xHis-tagged

  • Type:

    Developed Protein

  • Source:

    Yeast

  • Field of Research:

    Others

  • Relevance:

    Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all giniviruses, thereby initiating the rolling circle replication (RCR) . Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities .

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR) . Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities (By similarity) .

  • Molecular Weight:

    42.3 kDa

  • References & Citations:

    Nucleotide sequence of cassava latent virus DNA.Stanley J., Gay M.R.Nature 301:260-262 (1983)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length