Recombinant Human Mitochondrial import inner membrane translocase subunit Tim10 B (TIMM10B)

• Product Name Alternative:

  Fracture callus protein 1FxC1Mitochondrial import inner membrane translocase subunit Tim9 BTIMM10B ; Tim10b

• Abbreviation:

  Recombinant Human TIMM10B protein

• Gene Name:

  TIMM10B

• UniProt:

  Q9Y5J6

• Expression Region:

  1-103aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS

• Tag:

  N-terminal 6xHis-SUMO-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Signal Transduction

• Relevance:

  Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmbrane proteins into the mitochondrial inner mbrane. The TIM22 complex forms a twin-pore translocase that uses the mbrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70KDA complex that guides the target proteins in transit through the aqueous mitochondrial intermbrane space.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space.

• Molecular Weight:

  27.6 kDa

• References & Citations:

  Organization and function of the small Tim complexes acting along the import pathway of metabolite carriers into mammalian mitochondria.Muehlenbein N., Hofmann S., Rothbauer U., Bauer M.F.J. Biol. Chem. 279:13540-13546 (2004)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length