Recombinant Human C-C motif chemokine 19 (CCL19)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Recombinant Human C-C motif chemokine 19 (CCL19)
Product Name Alternative:
Beta-chemokine exodus-3CK beta-11Epstein-Barr virus-induced molecule 1 ligand chemokine ; EBI1 ligand chemokine ; ELCMacrophage inflammatory protein 3 beta ; MIP-3-beta; Small-inducible cytokine A19
Abbreviation:
Recombinant Human CCL19 protein
Gene Name:
CCL19
UniProt:
Q99731
Expression Region:
22-98aa
Organism:
Homo sapiens (Human)
Target Sequence:
GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Tag:
N-terminal GST-tagged
Type:
Developed Protein
Source:
E.coli
Field of Research:
Immunology
Relevance:
May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chokine receptor CCR7. Recombinant CCL19 shows potent chotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Endotoxin:
Not test
Purity:
Greater than 90% as determined by SDS-PAGE.
Activity:
Not Test
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function:
May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Molecular Weight:
35.8 kDa
References & Citations:
Beta-arrestin recruitment and G protein signaling by the atypical human chemokine decoy receptor CCX-CKR.Watts A.O., Verkaar F., van der Lee M.M., Timmerman C.A., Kuijer M., van Offenbeek J., van Lith L.H., Smit M.J., Leurs R., Zaman G.J., Vischer H.F.J. Biol. Chem. 288:7169-7181 (2013)
Storage Conditions:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length:
Full Length of Mature Protein