Recombinant Human Kynurenine--oxoglutarate transaminase 3 (CCBL2)

• Product Name Alternative:

  Cysteine-S-conjugate beta-lyase 2 (EC:4.4.1.13) Kynurenine aminotransferase III ; KATIIIKynurenine--glyoxylate transaminase (EC:2.6.1.63) Kynurenine--oxoglutarate transaminase III

• Abbreviation:

  Recombinant Human CCBL protein

• Gene Name:

  CCBL

• UniProt:

  Q6YP21

• Expression Region:

  1-454aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRSKPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYDTLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVGLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS

• Tag:

  N-terminal 6xHis-SUMO-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Signal Transduction

• Relevance:

  Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA) . May catalyze the beta-elimination of S-conjugates and Se-conjugates of L- (seleno) cysteine, resulting in the cleavage of the C-S or C-Se bond . Has transaminase activity towards L-kynurenine, tryptophan, phenylalanine, serine, cysteine, methionine, histidine, glutamine and asparagine with glyoxylate as an amino group acceptor (in vitro) . Has lower activity with 2-oxoglutarate as amino group acceptor (in vitro) .

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA) . May catalyze the beta-elimination of S-conjugates and Se-conjugates of L- (seleno) cysteine, resulting in the cleavage of the C-S or C-Se bond (By similarity) . Has transaminase activity towards L-kynurenine, tryptophan, phenylalanine, serine, cysteine, methionine, histidine, glutamine and asparagine with glyoxylate as an amino group acceptor (in vitro) . Has lower activity with 2-oxoglutarate as amino group acceptor (in vitro) (By similarity) .

• Molecular Weight:

  67.4 kDa

• References & Citations:

  Characterization of kynurenine aminotransferase III, a novel member of a phylogenetically conserved KAT family.Yu P., Li Z., Zhang L., Tagle D.A., Cai T.Gene 365:111-118 (2006)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length