Recombinant Human Peptidyl-tRNA hydrolase ICT1, mitochondrial (ICT1)

CAT:
399-GTR04831563
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Peptidyl-tRNA hydrolase ICT1, mitochondrial (ICT1)

  • Product Name Alternative:

    39S ribosomal protein L58, mitochondrial ; MRP-L58Digestion substraction 1 ; DS-1Immature colon carcinoma transcript 1 protein

  • Abbreviation:

    Recombinant Human ICT1 protein

  • Gene Name:

    ICT1

  • UniProt:

    Q14197

  • Expression Region:

    30-206aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    LHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD

  • Tag:

    N-terminal 6xHis-SUMO-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Metabolism

  • Relevance:

    Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been praturely terminated and thus in the recycling of stalled mitochondrial ribosomes.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes.

  • Molecular Weight:

    36.4 kDa

  • References & Citations:

    Identification of mRNAs that show modulated expression during colon carcinoma cell differentiation.van Belzen N., Diesveld M.P.G., van der Made A.C.J., Nozawa Y., Dinjens W.N.M., Vlietstra R., Trapman J., Bosman F.T.Eur. J. Biochem. 234:843-848 (1995)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein