Recombinant Crotalus adamanteus Thrombin-like enzyme crotalase (SVTLE)

• Product Name Alternative:

  Thrombin-like enzyme crotalase; SVTLE; EC 3.4.21.74; Fibrinogen-clotting enzyme; Snake venom serine protease 2; SVSP

• Abbreviation:

  Recombinant Crotalus adamanteus SVTLE protein

• Gene Name:

  SVTLE

• UniProt:

  F8S114

• Expression Region:

  25-262aa

• Organism:

  Crotalus adamanteus (Eastern diamondback rattlesnake)

• Target Sequence:

  VIGGDECNINEHRFLVALYDYWSQSFLCGGTLINEEWVLTAKHCDRTHILIYVGVHDRSVQFDKEQRRFPKEKYFFDCSNNFTKWDKDIMLIRLNKPVSYSEHIAPLSLPSSPPIVGSVCRAMGWGQTTSPQETLPDVPHCANINLLDYEVCRTAHPQFRLPATSRTLCAGVLEGGIDTCNRDSGGPLICNGQFQGIVFWGPDPCAQPDKPGLYTKVFDHLDWIQSIIAGEKTVNCPP

• Tag:

  N-terminal 6xHis-SUMO-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Thrombin-like snake venom protein that release fibrinopeptide A from fibrinogen (FGA) . Shows both kinin-releasing and coagulant activities.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Thrombin-like snake venom protein that release fibrinopeptide A from fibrinogen (FGA) . Shows both kinin-releasing and coagulant activities.

• Molecular Weight:

  42.8 kDa

• References & Citations:

  A high-throughput venom-gland transcriptome for the eastern diamondback rattlesnake (Crotalus adamanteus) and evidence for pervasive positive selection across toxin classes.Rokyta D.R., Wray K.P., Lemmon A.R., Lemmon E.M., Caudle S.B.Toxicon 57:657-671 (2011)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein